天堂网亚洲,天天操天天搞,91视频高清,菠萝蜜视频在线观看入口,美女视频性感美女视频,95丝袜美女视频国产,超高清美女视频图片

ChemicalBook--->CAS DataBase List--->52232-67-4

52232-67-4

52232-67-4 Structure

52232-67-4 Structure
IdentificationMore
[Name]

Teriparatide acetate
[CAS]

52232-67-4
[Synonyms]

[CYS5,28] PARATHYROID HORMONE (1-34), HUMAN
[CYS5,28] PTH (1-34), HUMAN
H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH
PARATHYROID HORMONE (1-34), HUMAN
PARATHYROID HORMONE (HUMAN, 1-34)
PARATHYROID HORMONE HUMAN: FRAGMENT 1-34
PTH (1-34) (HUMAN)
PTH (HUMAN, 1-34)
SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE
SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
TERIPARATIDE
Teriparatide acetate
Pth(1-34)(human) Acetate
PARATHYROID HORMONE FRAGMENT HUMAN 1-34 APPROX. 95%
PARATHYROID HORMONE FRAGMENT HUMAN 1-34 90-95%
Teriparatide, Parathyroid Hormone(1-34),human
parathyroid hormone fragment 1-34 human
PARATHYROID HORMONE (PTH) HUMAN 1-34, MIN 95%
(1-34)-HUMAN PARATHYROID HORMONE
[EINECS(EC#)]

640-978-1
[Molecular Formula]

C181H291N55O51S2
[MDL Number]

MFCD00149013
[MOL File]

52232-67-4.mol
[Molecular Weight]

4117.72
Chemical PropertiesBack Directory
[Melting point ]

>205oC (dec.)
[RTECS ]

SQ7770000
[storage temp. ]

−20°C
[solubility ]

DMSO (Slightly), Water (Slightly)
[form ]

powder
[color ]

White to Off-White
[biological source]

human
[Water Solubility ]

Soluble to 0.40 mg/ml in water
[Sequence]

H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
[Stability:]

Hygroscopic
[CAS DataBase Reference]

52232-67-4(CAS DataBase Reference)
Hazard InformationBack Directory
[Uses]

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.
[Description]

The anabolic drug teriparatide acetate (TA), known as recombinant human parathyroid hormone 1–34, which directly promotes bone formation by generating new osteocytes, has been introduced as a novel therapeutic agent for osteoporosis. Distinct from antiresorptive drug treatment, patients with osteonecrosis of the jaw showed successful clinical outcomes after weekly administration of TA. In addition, adverse outcomes of long-term bisphosphonate treatment, such as bone fracture, were healed after usage of TA, and better bone mass and mineral density improvements at the lumbar spine and femoral neck were achieved with TA treatment than with bisphosphonate treatment[1].
[General Description]

Teriparatide is a recombinantform of parathyroid hormone, which is used for the treatmentof osteoporosis in men and postmenopausal women.The N-terminal region possesses 34 amino acids, which areidentical to the biologically active region of the 84-aminoacid sequence of human parathyroid hormone. It has beenshown to act on osteoblasts to stimulate new bone growthand improve bone density.
[Biological Activity]

parathyroid hormone (1-34) (human), (c181h291n55o51s2), a peptide with the sequence h2n-svseiqlmhnlgkhlnsmervewlrkklqdvhnf-oh, mw= 4117.72. parathyroid hormone (pth), parathormone or parathyrin, is secreted by the chief cells of the parathyroid glands as a polypeptide containing 84 amino acids. it acts to increase the concentration of calcium (ca2+) in the blood, whereas calcitonin (a hormone produced by the parafollicular cells (c cells) of the thyroid gland) acts to decrease calcium concentration. pth acts to increase the concentration of calcium in the blood by acting upon the parathyroid hormone 1 receptor and the parathyroid hormone 2 receptor(1). parathyroid hormone regulates serum calcium, it enhances the release of calcium from the large reservoir contained in the bones(2). it enhances active reabsorption of calcium and magnesium from distal tubules and the thick ascending limb(3). it enhances the absorption of calcium in the intestine by increasing the production of activated vitamin d.figure1 formula of parathyroid hormone (1-34) (human)figure2 the parathyroid hormone (pth) system
[Biochem/physiol Actions]

Parathyroid hormone (PTH) is a parathyroid-secreted polypeptide hormone that increases the level of calcium in blood by enhancing calcium mobilization from bone, increasing the calcium:phosphate ratio in the kidney and promoting the absorption of calcium by the intestines. PTH is an anabolic agent that improves osteoblastic bone development. PTH 1-34 induces bone morphogenetic protein (BMP) gene transcription. Active N-terminal fragment of PTH (residues 1–34), has been used as a therapeutic for postmenopausal women with osteoporosis who are at high risk for fracture.
[Mechanism of action]

Teriparatide acetate is the salt form of teriparatide and has a similar mechanism of action to teriparatide. Teriparatide is a parathyroid hormone (PTH) analogue that regulates calcium and phosphate metabolism in bone and kidney by binding to the PTH type 1 receptor (PTH1R type) via the N-terminal portion. It has the same effect on calcium-phosphorus homeostasis as endogenous PTH (i.e., increases serum calcium and decreases serum phosphorus).
[Pharmacokinetics]

If administered once daily or intermittently, teriparatide preferentially enhances osteoblastic function,and bone formation occurs. Continuous exposure to endogenous PTH may result in poor skeletal composition because of enhanced osteoclast-mediated bone resorption. After 18 months of treatment, lumbar BMD increased up to 12% in postmenopausal women. After 10 months of treatment, 53% of men had an increase of 5% or greater in spine BMD. The risk for developing new vertebral fractures was reduced by 65% after 21 months of treatment, and the number of nonvertebral fragility fractures was reduced by 53%.
[Clinical Use]

In 2002, the U.S. FDA approved teriparatide for the treatment of postmenopausal osteoporosis in patients who have a high risk of fracture as well as to increase bone mass in men with primary or hypogonadal osteoporosis who have a high risk of fracture. Teriparatide is recombinant human PTH 1-34, the biologically active portion of the endogenously produced preprohormone. Unlike the bisphosphonates, which are classified as bone restorative agents, teriparatide is the first approved bone-forming agent. Bone formation is possible because of the ability of this agent to increase the number of osteoblasts. Although teriparatide enhances the function of both osteoclasts and osteoblasts, the exposure incidence dictates its effect on the skeleton.
[Side effects]

Temporary increases in serum calcium levels occur following administration of teriparatide. As a result, this agent is contraindicated in patients who are predisposed to hypercalcemia. Some evidence suggests that these elevations in serum calcium levels may cause a patient who is taking digitalis to experience digitalis toxicity (39). Teriparatide should not be prescribed to patients with Paget's disease, children, young adults, women who are pregnant or nursing, and those patients who have received skeletal radiation therapy. Because of an increased incidence of osteosarcoma (malignant bone tumors) observed in rats, teriparatide also carries a black box warning
[storage]

-20°C, away from moisture and light
[Dosage]

Teriparatide acetate requires subcutaneous injection into the thigh or abdominal wall, and the recommended dose is 20 mcg once daily. If symptoms of orthostatic hypotension occur, it is administered while the patient is sitting or lying down. It is not recommended to use the drug for more than 2 years in the lifetime of the patient. Use teriparatide injection with caution in patients receiving digoxin. Transient hypercalcemia may predispose patients to digitalis toxicity.
[References]

1. Bieglmayer C, Prager G, Niederle B (October 2002). "Kinetic analyses of parathyroid hormone clearance as measured by three rapid immunoassays during parathyroidectomy". Clin. Chem. 48 (10): 1731–8.2. PooleK, Reeve J (2005). "Parathyroid hormone - a bone anabolic and catabolic agent". Curr Opin Pharmacol 5 (6): 612–7.3. Coetzee M, Kruger MC (May 2004). "Osteoprotegerin-receptor activator of nuclear factor-kappaB ligand ratio: a new approach to osteoporosis treatment?". South. Med. J. 97 (5): 506–11.
Safety DataBack Directory
[WGK Germany ]

3
[HS Code ]

2937190000
[Hazardous Substances Data]

52232-67-4(Hazardous Substances Data)
Questions And AnswerBack Directory
[Application in Particular Diseases]

In Osteoporosis:
  • Teriparatide is a recombinant product representing the first 34 amino acids in human parathyroid hormone. Teriparatide increases bone formation, the bone remodeling rate, and osteoblast number and activity. Both bone mass and architecture are improved.
  • Teriparatide is FDA approved for postmenopausal women and men who are at high risk for fracture. Candidates for therapy include patients with a history of osteoporotic fracture, multiple risk factors for fracture, very low bone density (e.g., T-score <–3.5), or those who have failed or are intolerant of previous bisphosphonate therapy.
  • The drug reduces fracture risk in postmenopausal women, but no fracture data are available in men. Lumbar spine BMD increases are higher than with any other osteoporosis therapy. Although wrist BMD is decreased, wrist fractures are not increased.
  • Discontinuation of therapy results in a decrease in BMD, but some antifracture efficacy appears to be maintained. Sequential therapy with teriparatide followed by an antiresorptive agent (e.g., bisphosphonate) should be considered to maintain BMD gains.
  • The dose is 20 mcg administered subcutaneously in the thigh or abdominal area (see Table 3-4). The initial dose should be given with the patient either lying or sitting, in case orthostatic hypotension occurs. Each prefilled 3-mL pen device delivers a 20-mcg dose each day for up to 28 days; the pen device should be kept refrigerated.
  • Transient hypercalcemia rarely occurs. A trough serum calcium concentration is recommended 1 month after initiation of therapy.
  • Teriparatide is contraindicated in patients at baseline increased risk for osteosarcoma (e.g., Paget’s bone disease, unexplained alkaline phosphatase elevations, pediatric patients, young adults with open epiphyses, or patients with prior radiation therapy involving the skeleton).
Spectrum DetailBack Directory
[Spectrum Detail]

Teriparatide acetate(52232-67-4)MS
52232-67-4 suppliers list
Company Name: Sea Biological Co.,LTD
Tel: +86-13865152372 +86-13865152372 , +86-13865152372
Website: www.sea-biol.com/
Company Name: Cellmano Biotech Limited
Tel: 0551-65326643 18156095617 , 18156095617
Website: http://www.cellmano.com/
Company Name: Zibo Hangyu Biotechnology Development Co., Ltd
Tel: +86-0533-2185556 +8615965530500 , +8615965530500
Website: m.approvedhomemanagement.com/manufacturer/hangyu-chemical-25178/
Company Name: Shaanxi TNJONE Pharmaceutical Co., Ltd
Tel: +86-17396673057
Website: tnjone.com
Company Name: Shandong Deshang Chemical Co., Ltd.
Tel: +86-0531-8875-2665 +8613153039501 , +8613153039501
Website: www.deshangchemical.com
Company Name: Rixing Chemical CO.,LTD.
Tel: +86-852-57055271 +8613237129059 , +8613237129059
Website: www.rixingbiz.com
Company Name: American HealthyMorph LLC
Tel: +852-69498027 +86-13363867578 , +86-13363867578
Website: m.approvedhomemanagement.com/manufacturer/american-healthymorph-25429/
Company Name: Wuhan Biocar Pharmacy CO.,Ltd.
Tel: +86-86-13343427080 +8613343427080 , +8613343427080
Website: www.biocarchem.com
Company Name: Shanghai Yunao International Trade Co., Ltd
Tel: +8617621705551 , +8617621705551
Website: m.approvedhomemanagement.com/manufacturer/shanghai-yunao-international-trade-414/product_0_1.htm
Company Name: Shandong Huisheng Import & Export Co., Ltd.
Tel: +86-13176845580 +86-13176845580 , +86-13176845580
Website: m.approvedhomemanagement.com/manufacturer/shandong-huisheng-import-export-25188/
Company Name: Anhui Zhongda Biotechnology Co., Ltd
Tel: +8619956560829 , +8619956560829
Website:
Company Name: Anhui Ruihan Technology Co., Ltd
Tel: +8617756083858 , +8617756083858
Website: m.approvedhomemanagement.com/manufacturer/anhui-ruihan-technology/
Company Name: Nantong Guangyuan Chemicl Co,Ltd
Tel: +undefined17712220823 , +undefined17712220823
Website: m.approvedhomemanagement.com/manufacturer/nantong-guangyuan-pharmaceutical-technology-25216/
Company Name: Henan Fengda Chemical Co., Ltd
Tel: +86-371-86557731 +86-13613820652 , +86-13613820652
Website: http://www.fdachem.com
Company Name: Shanghai Affida new material science and technology center
Tel: +undefined15081010295 , +undefined15081010295
Website: m.approvedhomemanagement.com/manufacturer/shanghai-affida-new-material-science-and-technology-center-25277/
Company Name: airuikechemical co., ltd.
Tel: +86-18353166132 +86-18353166132 , +86-18353166132
Website: airuikechemical.com/
Company Name: Hangzhou Hyper Chemicals Limited
Tel: +86-0086-57187702781 +8613675893055 , +8613675893055
Website: www.hyper-chem.com
Company Name: hebei hongtan Biotechnology Co., Ltd
Tel: +852-6619 3215 +86-17731935328 , +86-17731935328
Website: hbht123.com
Tags:52232-67-4 Related Product Information
121062-08-6 50-56-6 140194-24-7 10813-74-8 16679-58-6 105184-37-0 196078-30-5 20071-00-5 320367-13-3 99294-94-7 14636-12-5 16960-16-0 86220-42-0 129311-55-3 74381-53-6 148031-34-9 69-25-0 103222-11-3

  • HomePage | Member Companies | Advertising | Contact us | Previous WebSite | MSDS | CAS Index | CAS DataBase | Privacy | Terms | About Us
  • All products displayed on this website are only for non-medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.
    According to relevant laws and regulations and the regulations of this website, units or individuals who purchase hazardous materials should obtain valid qualifications and qualification conditions.
  • Copyright © 2023 ChemicalBook All rights reserved.